DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and Aqp8

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_062031.1 Gene:Aqp8 / 29172 RGDID:2146 Length:263 Species:Rattus norvegicus


Alignment Length:227 Identity:83/227 - (36%)
Similarity:115/227 - (50%) Gaps:16/227 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ELAATAVFVFIACMGCVE----TPLFQNSHFRSGLTFGLAILIAIQCFGSVSGAHLNPAITLAAW 93
            ||..:|:|:||.|:..:|    |.|.|     ..|..|||:.:.|...|::||.|.|||::||..
  Rat    43 ELLGSALFIFIGCLSVIENSPNTGLLQ-----PALAHGLALGLIIATLGNISGGHFNPAVSLAVT 102

  Fly    94 LYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCVTILAPGISVLQGVFIEF 158
            |.|.:..:..|.|:|:|..|.:||..|...|.|.....   |.||....|:.....|.:.:.:|.
  Rat   103 LVGGLKTMLLIPYWVSQLFGGMIGAALAKVVSPEERFW---NASGAAFAIVQEQEQVAEALGVEI 164

  Fly   159 LITCCLVMVACSVWDPRNAKLQDSV-PVRFGLTVSCLILTAGLFTGASMNPTRSLGPAVWNDSWA 222
            ::|..||:..|  ....|.|....: |...|.:|...||..|..:||.|||.|:.||||....|.
  Rat   165 VMTMLLVLAVC--MGAVNEKTMGPLAPFSIGFSVIVDILAGGGISGACMNPARAFGPAVMAGYWD 227

  Fly   223 HHWIYWVGPLVAGAVTSLIYRMAFKGDEEIDL 254
            .|||||:|||:||....|:.|: |.|||:..|
  Rat   228 FHWIYWLGPLLAGLFVGLLIRL-FIGDEKTRL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 77/215 (36%)
Aqp8NP_062031.1 MIP 40..250 CDD:294134 78/217 (36%)
NPA 1 94..96 1/1 (100%)
NPA 2 212..214 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334471
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.