DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and Aqp7

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_062030.2 Gene:Aqp7 / 29171 RGDID:2145 Length:269 Species:Rattus norvegicus


Alignment Length:246 Identity:62/246 - (25%)
Similarity:106/246 - (43%) Gaps:29/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QRSAIACFFGELAATAVFVFIACMGCVETPLFQ--NSHFRSGLTFGLAILIAIQCFGSVSGAHLN 85
            |::.:..|..|..:|.|.:...........|.:  .|:....|.||..:.:.|...|.:||||:|
  Rat    14 QKTWVREFLAEFLSTYVLMVFGLGSVAHMVLGERLGSYLGVNLGFGFGVTMGIHVAGGISGAHMN 78

  Fly    86 PAITLAAWLYGAIGWIRAIAY--------FVAQAAGALIGYGLLVAVLPGN-SIKGVDNPSGVCV 141
            .|:|......|.:.|.:...|        |:|.|...||.||.:.....|. .:.|..:.:.:..
  Rat    79 AAVTFTNCALGRMAWKKFPIYVLGQFLGSFLAAATTYLIFYGAINHYAGGELLVTGPKSTANIFA 143

  Fly   142 TILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNA-KLQDSVPVRFGLTVSCLILTAGLFTGAS 205
            |.|...:::.:|...|..:|..|.:...::.|..|: .||.:.|:..|:.|..|.::.|:.||.:
  Rat   144 TYLPEHMTLWRGFVDEVFVTGMLQLCIFAITDKLNSPALQGTEPLMIGILVCVLGVSLGMNTGYA 208

  Fly   206 MNPTRSLGP------AVW--------NDSWAHHWIYWVGPLVAGAVTSLIY 242
            :||:|.|.|      |.|        |:.|   |:..|.||:...:..::|
  Rat   209 INPSRDLPPRFFTFIAGWGKKVFSAGNNWW---WVPVVAPLLGAYLGGIVY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 61/239 (26%)
Aqp7NP_062030.2 MIP 15..260 CDD:412216 61/245 (25%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P55064 78..80 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P55064 210..212 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334458
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.