DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and Mip

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001099189.1 Gene:Mip / 25480 RGDID:3090 Length:263 Species:Rattus norvegicus


Alignment Length:232 Identity:77/232 - (33%)
Similarity:118/232 - (50%) Gaps:20/232 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 WRLEGHQRSAI--ACFFGELAATAVFVFI---ACMGCVETPLFQNSH-FRSGLTFGLAILIAIQC 75
            |.|    |||.  ...|.|..||..:||.   :.:.....||    | .:..|.||||:...:|.
  Rat     2 WEL----RSASFWRAIFAEFFATLFYVFFGLGSSLRWAPGPL----HVLQVALAFGLALATLVQT 58

  Fly    76 FGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVC 140
            .|.:||||:|||:|.|..:...:..:||..|..||..||:.|..:|.:|.| .:::|     .:.
  Rat    59 VGHISGAHVNPAVTFAFLVGSQMSLLRAFCYIAAQLLGAVAGAAVLYSVTP-PAVRG-----NLA 117

  Fly   141 VTILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGAS 205
            :..|..|:||.|...:|..:|...|:...:.:|.|......||.:..|.:::...|....:|||.
  Rat   118 LNTLHAGVSVGQATTVEIFLTLQFVLCIFATYDERRNGRMGSVALAVGFSLTLGHLFGMYYTGAG 182

  Fly   206 MNPTRSLGPAVWNDSWAHHWIYWVGPLVAGAVTSLIY 242
            |||.||..||:...::::||:|||||::.|.:.||:|
  Rat   183 MNPARSFAPAILTRNFSNHWVYWVGPIIGGGLGSLLY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 72/217 (33%)
MipNP_001099189.1 MIP 3..219 CDD:278651 75/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334479
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.