DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and aqp-3

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_502044.1 Gene:aqp-3 / 190553 WormBaseID:WBGene00000171 Length:421 Species:Caenorhabditis elegans


Alignment Length:280 Identity:71/280 - (25%)
Similarity:119/280 - (42%) Gaps:46/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IACFFGELAATAVFVFIACMG--CVETPLF-----QNSHFRSGLTFGLAILIAIQCFGSVSGAHL 84
            |..|..||..|...||    |  ||.....     .|......:.:||.:::|:.....:|||||
 Worm   120 IRAFLAELFCTGFLVF----GGECVNAQYVLSQGKNNEWIGISVGWGLVLMLAVLMGSKISGAHL 180

  Fly    85 NPAITLAAWLYGAIGWIRAIAYFVAQAAGALIG-YGLL------VAVLPG--NSIKGVDNPSGVC 140
            |||::......|.|..||.:.|.|||..||.:| :|:.      :.|..|  .::.|....:.:.
 Worm   181 NPAVSFFQLTQGKINLIRFLVYAVAQNIGAFLGAFGVFCVYYDAINVFEGGNRTVTGPTATASIF 245

  Fly   141 VTILAPGISVLQGVFIEFLITCCLVMVACSVWDPRN---AKLQDSVPVRFGLTVSCLILTAGLFT 202
            .|...|.:.....:..:...|..|.:...::.|.||   |.||   |...|..::.|.::..|..
 Worm   246 ATYPGPFLGTFNAIVDQIAGTLVLCLGVAAITDRRNGIPAFLQ---PAWIGALLAFLGMSLALNA 307

  Fly   203 GASMNPTRSLGPAVWN------------DSWAHHWIYWVGPLVAGAVTSLIYRMAFKG----DEE 251
            |.::||.|...|.::|            .::...||..:.|::.|.:.:.:|.. |.|    ||:
 Worm   308 GYAINPARDFAPRLFNLCAGYGWEVFSYRNYKWFWIPIICPMIGGVLGAWLYEF-FIGFHIQDED 371

  Fly   252 -IDLRT-SDAKIR-MIGEVI 268
             :.|.: ||.::: ||..::
 Worm   372 AVSLDSESDKQLKTMIDNMV 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 61/244 (25%)
aqp-3NP_502044.1 MIP 121..362 CDD:238204 61/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.869916 Normalized mean entropy S1906
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.660

Return to query results.
Submit another query.