DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and aqp-6

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001256246.1 Gene:aqp-6 / 183121 WormBaseID:WBGene00000174 Length:291 Species:Caenorhabditis elegans


Alignment Length:236 Identity:74/236 - (31%)
Similarity:111/236 - (47%) Gaps:26/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ELAATAVFVFIACMGCVETPLFQNSHFRSGLTFGLAILIAIQCFGSVSGAHLNPAITLAAWLYGA 97
            |..|..:||:|..|..... ...:....:....|:||.:....||.|||||:|||:|....|.|.
 Worm    64 EFIAVLLFVYIGSMQAAGV-FLHDGVLHAAFAHGVAIFVLAATFGGVSGAHINPAVTFGIALVGR 127

  Fly    98 IGWIRAIAYFVAQAAGALIGYGLLVAV-LPGNSIKGVDNPSGVCVTILAPGISVLQGVFIEFLIT 161
            |..|.|:.|.|:|..|::.| .|||.: ||..    :.|......|:...|.:..:|:..|.:.|
 Worm   128 ISPIHAVCYVVSQLLGSVFG-ALLVRISLPYK----MYNVISAGATLCGKGYNWQEGLTAEIVTT 187

  Fly   162 CCLV--MVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRSLGPAVWND----- 219
            ..||  ::.|:|...:|.    ..|:..|.::...||.||..:||||||.||.||.:...     
 Worm   188 YILVQTVLLCAVDTDKNR----LAPLAIGFSLIIEILAAGAISGASMNPARSFGPNIMGQVFLKP 248

  Fly   220 --------SWAHHWIYWVGPLVAGAVTSLIYRMAFKGDEEI 252
                    .|.:||||::||::...:.:.:|||.|..|..:
 Worm   249 EHLDAQYMYWNYHWIYYIGPIIGAFIAAGVYRMFFARDYRV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 70/226 (31%)
aqp-6NP_001256246.1 MIP 60..282 CDD:238204 71/227 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I3512
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I3275
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm4734
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.