DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and aqp-7

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001379301.1 Gene:aqp-7 / 180589 WormBaseID:WBGene00000175 Length:302 Species:Caenorhabditis elegans


Alignment Length:263 Identity:72/263 - (27%)
Similarity:111/263 - (42%) Gaps:47/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QQKQKSQESNPNARWRLEGHQRSAIACFFGELAATAVFVFIACMGCVETPLFQNSHFRS----GL 63
            |.:.|.|..||..        |:|::.|||    |.:.:||. :|.|...:..|....:    .|
 Worm    21 QVRAKIQIKNPLL--------RNALSEFFG----TFLLLFIG-IGIVMQFILSNEKLNTWININL 72

  Fly    64 TFGLAILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGN 128
            .:||||...:......||.|.|||:::|....|.:.:...:.|.|.|..||.:|......:....
 Worm    73 GWGLAIAFTVYTCSKTSGGHFNPAVSIAFLTLGKLPFKDFLVYCVVQTIGAALGSAAAFGLYYDQ 137

  Fly   129 SIKGVDNPSGVCVTILAP-------------GISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQ 180
            .:|.    :|...|||.|             .:|.....|.:|..|..||:..|.|.|.||....
 Worm   138 FVKF----AGAYRTILGPKATAGCFCSYPALHVSNTTAFFDQFAGTALLVLFVCVVIDKRNGIPG 198

  Fly   181 DSVPVRFGLTVSCLILTAGLFTGASMNPTRSLGPAVWN--------DSWAHHWIYWVGPLVA--- 234
            .:.|:.|||.|..:....|:..|..:||.|.|||.:::        .|: |.:.:|: |::|   
 Worm   199 AAHPLLFGLVVMMIGTAYGMNLGYPINPARDLGPRLFSFFIYGSGVFSY-HSYYFWI-PVIAPLF 261

  Fly   235 GAV 237
            ||:
 Worm   262 GAI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 65/236 (28%)
aqp-7NP_001379301.1 MIP 34..273 CDD:238204 67/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.