DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and aqp-4

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_505512.3 Gene:aqp-4 / 179366 WormBaseID:WBGene00000172 Length:273 Species:Caenorhabditis elegans


Alignment Length:237 Identity:78/237 - (32%)
Similarity:115/237 - (48%) Gaps:27/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IACFFGELAATAVFVFIACMGCVETPLFQ--NSHFRSGLTFGLAILIAIQCFGSVSGAHLNPAIT 89
            :|.|.|:|    .||::   |.::..|||  :....:....|..|.|.:..||.:||.|.|||::
 Worm    48 VAEFLGDL----TFVYV---GTMQASLFQYADGILHAAFAHGFTIFILVTAFGHISGGHFNPAVS 105

  Fly    90 LAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCVTILAPGISVLQGV 154
            .|....|.:.......|.|:|..|.:.|..|..|||....:...:  :|  .|:|:||....||:
 Worm   106 WAIAGAGKMPIFHLPFYVVSQLLGGICGAFLTAAVLSQEQLTSCE--AG--ATLLSPGSQWWQGL 166

  Fly   155 FIEFLITCCLV-MVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRSLGPAVWN 218
            ..|.::|..|| .:..:..|.....|   .|:..|||:|..||:.|..|||||||.|||||::..
 Worm   167 IAETVVTFFLVHTILITAADTDTVTL---APLAIGLTLSIDILSTGSITGASMNPARSLGPSIIG 228

  Fly   219 D---------SWAHHWIYWVGPLVAGAVTSLIYRMAFKGDEE 251
            .         .|.:|:|||.|||:...:...||:: |:..||
 Worm   229 SIFATQKTSFYWNNHYIYWAGPLLGSTIALCIYKL-FESREE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 74/225 (33%)
aqp-4NP_505512.3 MIP 46..264 CDD:238204 75/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156133
Domainoid 1 1.000 121 1.000 Domainoid score I3512
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I3275
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm4734
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.