DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and Aqp8

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_031500.1 Gene:Aqp8 / 11833 MGIID:1195271 Length:261 Species:Mus musculus


Alignment Length:244 Identity:85/244 - (34%)
Similarity:121/244 - (49%) Gaps:17/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RWRLEGHQRSAIACFFGELAATAVFVFIACMGCVE----TPLFQNSHFRSGLTFGLAILIAIQCF 76
            |.|:..:::....|.. ||..:|:|:||.|:..:|    |.|.|     ..|..|||:.:.|...
Mouse    25 RCRVFWYEQYVQPCIV-ELVGSALFIFIGCLSVIENSPNTGLLQ-----PALAHGLALGLIIATL 83

  Fly    77 GSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCV 141
            |::||.|.|||::||..:.|.:..:..|.|:::|..|.|||..|...|.|.....   |.||...
Mouse    84 GNISGGHFNPAVSLAVTVIGGLKTMLLIPYWISQLFGGLIGAALAKVVSPEERFW---NASGAAF 145

  Fly   142 TILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSV-PVRFGLTVSCLILTAGLFTGAS 205
            .|:.....|.:.:.||.::|..||:..|  ....|.|....: |...|.:|...||..|..:||.
Mouse   146 AIVQEQEQVAEALGIEIILTMLLVLAVC--MGAVNEKTMGPLAPFSIGFSVIVDILAGGSISGAC 208

  Fly   206 MNPTRSLGPAVWNDSWAHHWIYWVGPLVAGAVTSLIYRMAFKGDEEIDL 254
            |||.|:.||||....|..|||||:|||:||....|:.|:.. |||:..|
Mouse   209 MNPARAFGPAVMAGYWDFHWIYWLGPLLAGLFVGLLIRLLI-GDEKTRL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 77/218 (35%)
Aqp8NP_031500.1 MIP 38..248 CDD:294134 79/220 (36%)
NPA 1 92..94 1/1 (100%)
NPA 2 210..212 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830759
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.780

Return to query results.
Submit another query.