DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and Aqp7

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001365567.1 Gene:Aqp7 / 11832 MGIID:1314647 Length:316 Species:Mus musculus


Alignment Length:207 Identity:51/207 - (24%)
Similarity:96/207 - (46%) Gaps:12/207 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QRSAIACFFGELAATAVFVFIACMGCVETPLFQN--SHFRSGLTFGLAILIAIQCFGSVSGAHLN 85
            |::.:..|..|..:|.|.:...........|.:|  |:....|.||..:.:.:...|.:||||:|
Mouse    15 QKNMVREFLAEFLSTYVMMVFGLGSVAHMVLGENSGSYLGVNLGFGFGVTMGVHVAGGISGAHMN 79

  Fly    86 PAITLAAWLYGAIGWIRAIAYFVAQAAGA--------LIGYGLLVAVLPGN-SIKGVDNPSGVCV 141
            .|:|......|.:.|.:...|.:.|..|:        ||.||.:.....|: .:.|....:.:..
Mouse    80 AAVTFTNCALGRMTWKKFPVYVLGQFLGSFSAAATTYLIFYGAINHFAGGDLLVTGSKATANIFA 144

  Fly   142 TILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNA-KLQDSVPVRFGLTVSCLILTAGLFTGAS 205
            |.|...:::.:|...|..:|..|.:...::.|.:|: .||.:.|:..|:.|:.|.::.|:.:|.:
Mouse   145 TYLPEYMTLWRGFLDEAFVTGMLQLCLFAITDKKNSPALQGTEPLVIGILVTVLGVSLGMNSGYA 209

  Fly   206 MNPTRSLGPAVW 217
            :||:|.|.|.::
Mouse   210 INPSRDLPPRLF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 50/200 (25%)
Aqp7NP_001365567.1 MIP 18..232 CDD:412216 50/204 (25%)
NPA 1 79..81 1/1 (100%)
NPA 2 211..213 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830746
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.