DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and Aqp3

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_057898.2 Gene:Aqp3 / 11828 MGIID:1333777 Length:292 Species:Mus musculus


Alignment Length:277 Identity:76/277 - (27%)
Similarity:120/277 - (43%) Gaps:47/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQQKQKSQESNP--NARWRLEGHQRSAIACFFGELAATAVFVFIACMGCVETPLFQNSH---FR 60
            |.:||:.......  :.|:||   .|.|:|    |...|.:.|...|....:..|.:.:|   ..
Mouse     1 MGRQKELMNRCGEMLHIRYRL---LRQALA----ECLGTLILVMFGCGSVAQVVLSRGTHGGFLT 58

  Fly    61 SGLTFGLAILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLL---- 121
            ..|.||.|:.:.|...|.|||||||||:|.|........||:...|.:||..||.:|.|::    
Mouse    59 INLAFGFAVTLGILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYALAQTLGAFLGAGIVFGLY 123

  Fly   122 ---VAVLPGNS--IKGVDNPSGVCVTILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQD 181
               :.....|.  :.|.:..:|:..|..:..:.::.|.|.:|:.|..|::...::.||.|.    
Mouse   124 YDAIWAFANNELFVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTAALIVCVLAIVDPYNN---- 184

  Fly   182 SVPVRFGL---TVSCLIL----TAGLFTGASMNPTRSLGP------AVWND---SWAHHWIYW-- 228
              ||..||   ||..::|    :.|..:|.::||.|..||      |.|..   :...|| :|  
Mouse   185 --PVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSEVFTTGRHW-WWVP 246

  Fly   229 -VGPLVAGAVTSLIYRM 244
             |.||:.......:|::
Mouse   247 IVSPLLGSIAGVFVYQL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 67/244 (27%)
Aqp3NP_057898.2 MIP 23..264 CDD:238204 70/252 (28%)
NPA 1. /evidence=ECO:0000250|UniProtKB:Q96PS8 83..85 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:Q96PS8 215..217 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830728
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.869916 Normalized mean entropy S1906
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.620

Return to query results.
Submit another query.