DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and LOC101885864

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_005174182.1 Gene:LOC101885864 / 101885864 -ID:- Length:277 Species:Danio rerio


Alignment Length:191 Identity:64/191 - (33%)
Similarity:96/191 - (50%) Gaps:20/191 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LTFGLAILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPG 127
            |..|:|.::...|||.:|||.:|||:|:|......:..:||:.|.|||..|.::..||:...||.
Zfish    50 LAAGMATVVLGYCFGEISGAQVNPAVTVALLATRKVDVLRAVVYLVAQCLGGILATGLMYLSLPL 114

  Fly   128 NSIK-------GVDNPSGVCVTILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPV 185
            .|..       .|:..:|             |.:.:|.|.|..|.....||.|.|..::.:...:
Zfish   115 KSTAQNYINKVPVEMNAG-------------QALGMEMLATFLLGFTVFSVEDQRRREINEPGNL 166

  Fly   186 RFGLTVSCLILTAGLFTGASMNPTRSLGPAVWNDSWAHHWIYWVGPLVAGAVTSLIYRMAF 246
            ..||.|:..|..||.|:|||:||.||||||:....|.|||:||:||::...:..:.:...|
Zfish   167 AIGLAVTTAIFIAGRFSGASLNPARSLGPAIILGYWEHHWVYWIGPILGAVLAGVSHEFIF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 63/187 (34%)
LOC101885864XP_005174182.1 MIP 6..223 CDD:412216 63/185 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.