DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and mindy4

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_002663449.3 Gene:mindy4 / 100537560 ZFINID:ZDB-GENE-110411-104 Length:683 Species:Danio rerio


Alignment Length:145 Identity:32/145 - (22%)
Similarity:44/145 - (30%) Gaps:42/145 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 PGNSIKGVDNPSGVCVTILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLT 190
            ||.....|....|.|..:.|....||:.:..|        ..:|           |||..|  |.
Zfish   363 PGLKYGIVQKKGGPCGVLAAVQACVLEKLLFE--------ESSC-----------DSVDQR--LE 406

  Fly   191 VSCLILTAGLFTGASMNPTRSLGPAVWNDSWAHHWIYWVGPLVAGAVTSLIYRMAFKGDEEIDLR 255
            ||.::.|..|:.        :|...:|.          .|.:....|.....|..|   ..|...
Zfish   407 VSSIVRTKCLYL--------ALADVIWR----------AGNMNRATVAINTGRSVF---TPIGRY 450

  Fly   256 TSDAKIRMIGEVIVQ 270
            .||..:.||..|.|:
Zfish   451 KSDGILEMITYVTVE 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 23/117 (20%)
mindy4XP_002663449.3 DUF4205 337..678 CDD:290609 32/145 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.