DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and LOC100509620

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_006712950.1 Gene:LOC100509620 / 100509620 -ID:- Length:375 Species:Homo sapiens


Alignment Length:273 Identity:63/273 - (23%)
Similarity:116/273 - (42%) Gaps:40/273 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EGHQRSAIACFFGELAATAVFVFIACMGCVETPLFQ---NSHFRSGLTFGLAILIAIQCFGSVSG 81
            |..:|..:..|..|..:|.|.:... :|.|...:..   .|:....|.||..:.:.:...|.:||
Human    60 EEDERKMVREFLAEFMSTYVMMVFG-LGSVAHMVLNKTYGSYLGVNLGFGFGVTMGVHVAGRISG 123

  Fly    82 AHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIG----YGLL-VAVLPGNS----IKGVDNPS 137
            ||:|.|:|......|.:.|.:...:.:.|..|:.:.    |.|. .|:|..:.    :.|....:
Human   124 AHMNAAVTFTNCALGRVPWRKFPVHVLGQFLGSFLAAATIYSLFYTAILHFSGGELMVTGPFATA 188

  Fly   138 GVCVTILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLI----LTA 198
            |:..|.|...:::.:|...|..:|..|.:...::.|..|   ..::|....|.:|.|:    ::.
Human   189 GIFATYLPDHMTLWRGFLNEEWLTRMLQLCLFTITDQEN---NPALPGTHALVISILVVIIRVSH 250

  Fly   199 GLFTGASMNPTRSLGPAV------W-------NDSWAHHWIYWVGPLVAGAVTSLIYRMAFKGD- 249
            |:.||.::||:|...|::      |       .::|  .|:..|.||:..::..:|| :.|.|. 
Human   251 GINTGYAINPSRDPPPSIFTFIAGWGKQVFSDGENW--WWVPVVAPLLGASLGGIIY-LVFIGST 312

  Fly   250 ---EEIDLRTSDA 259
               |.:.|..|.|
Human   313 IPREPLKLEDSVA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 55/242 (23%)
LOC100509620XP_006712950.1 MIP 64..313 CDD:294134 58/255 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140773
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.