DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and LOC100491830

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_012813770.2 Gene:LOC100491830 / 100491830 -ID:- Length:276 Species:Xenopus tropicalis


Alignment Length:218 Identity:77/218 - (35%)
Similarity:104/218 - (47%) Gaps:6/218 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SAIACFFGELAATAVFVFIACMGCVETPLFQNSHFRSGLTFGLAILIAIQCFGSVSGAHLNPAIT 89
            |.:...|.|...|..||.:.....:..|....:..:..|||||||...:|..|.:|.||||||:|
 Frog    15 SFLRSLFAEFLGTLFFVLLGLSSTLSWPKALPAALQISLTFGLAIATMVQTMGHISKAHLNPAVT 79

  Fly    90 LAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCVTILAPGISVLQGV 154
            :|..|...|...:|:.|...|..||::|.|||....|.| :.|     ...|.:|:.|.|..||.
 Frog    80 VAFLLAAHISISKAVLYITVQVLGAVVGAGLLYKFTPSN-LHG-----NFGVNLLSNGTSPGQGF 138

  Fly   155 FIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRSLGPAVWND 219
            .:|.|.|..||:...:..|........|..:..||:|:........|||.||||.||..||:...
 Frog   139 AVEVLTTMQLVLCIFATTDSHRMDNIGSPSISIGLSVTLGHFLGIYFTGCSMNPARSFAPALITG 203

  Fly   220 SWAHHWIYWVGPLVAGAVTSLIY 242
            ::..||:.||||:..|...||||
 Frog   204 NFTDHWVVWVGPMAGGIFASLIY 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 76/213 (36%)
LOC100491830XP_012813770.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.