DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and aqp5

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001297041.1 Gene:aqp5 / 100491662 XenbaseID:XB-GENE-479726 Length:289 Species:Xenopus tropicalis


Alignment Length:216 Identity:75/216 - (34%)
Similarity:110/216 - (50%) Gaps:14/216 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FGELAATAVFVFIACMGCVETPLFQNSHFRSGLTFGLAILIAIQCFGSVSGAHLNPAITLAAWLY 95
            |.|..||.:|||......:..|....:..:..|.|||.|...:|..|.:||||:|||:|::..:.
 Frog    15 FAEFLATLIFVFFGLGSALRWPAALPTVLQISLAFGLVIGTLVQSVGHISGAHINPAVTMSFLVG 79

  Fly    96 GAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCVTILA----PGISVLQGVFI 156
            ..|..|||..|.:||..|.|.|.|:|..|:..| ::|     .:.:..|:    ||::.:    :
 Frog    80 SQISLIRAFFYIIAQLLGGLAGAGILYGVVSPN-VRG-----NLAINTLSNNITPGVAFV----V 134

  Fly   157 EFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRSLGPAVWNDSW 221
            |.::|..|||...:..|.|......|..:..||:|:...|....|||.||||.||..|||....:
 Frog   135 EMILTFQLVMCIFASTDSRREDNVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFAPAVVVRRF 199

  Fly   222 AHHWIYWVGPLVAGAVTSLIY 242
            .:||::|:|||..|.:.||.|
 Frog   200 TNHWVFWIGPLAGGMLASLTY 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 75/216 (35%)
aqp5NP_001297041.1 MIP 4..220 CDD:333943 74/214 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.