DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and aqp10

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_002943404.2 Gene:aqp10 / 100490571 XenbaseID:XB-GENE-480662 Length:330 Species:Xenopus tropicalis


Alignment Length:279 Identity:69/279 - (24%)
Similarity:115/279 - (41%) Gaps:51/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SNPNARWRLEGH-------------------QRSAIACFFGELAATAVFVFIACMGCV--ETPLF 54
            |:.::.|.|.|.                   .|..:|.|.|......:.|.....|..  ||   
 Frog    14 SSFSSAWHLSGMAWWRSRRDLRSCLRLRNPLARECLAEFLGVFVLLLITVAATAQGVTSNET--- 75

  Fly    55 QNSHFRSGLTFGLAILIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIG-- 117
            :.:.|...|...:|:::||...|.|||.|||||.:|:..:.|...|.:...|.:.|..|:..|  
 Frog    76 RGNFFCMYLAGAIAVVLAIYISGGVSGGHLNPAYSLSMCILGRFPWWKLPLYALIQLVGSFAGAA 140

  Fly   118 ------YGLLVAVLPGN-SIKGVDNPSGVCVTILAPGISVLQGVFIEFLITCCLVMVACSVWDPR 175
                  |..:.....|| ::.|....:.:..:..||.:|:..|...:.:.|..|::...::.|.:
 Frog   141 AAFALYYDAIRDYTKGNLTVFGPRETASIFSSYPAPYLSIGNGFLDQVMGTAMLMVGILAIVDSK 205

  Fly   176 NAKLQDSV-PVRFGLTVSCLILTAGLFTGASMNPTRSLGP------AVW--------NDSWAHHW 225
            |..:...: |:..|:.|.|:.|:.|...|..:||||.|||      |.|        |:.|   |
 Frog   206 NKPVPRGLEPIVVGMLVFCIGLSMGANCGYPINPTRDLGPRLFTAVAGWGLDVFRAGNNWW---W 267

  Fly   226 IYWVGPLVAGAVTSLIYRM 244
            :..|.|.|...:.|::|::
 Frog   268 VPVVAPCVGAVLGSILYQI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 63/239 (26%)
aqp10XP_002943404.2 MIP 38..288 CDD:294134 65/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.