DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and LOC100489792

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_002935778.1 Gene:LOC100489792 / 100489792 -ID:- Length:267 Species:Xenopus tropicalis


Alignment Length:246 Identity:79/246 - (32%)
Similarity:113/246 - (45%) Gaps:26/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FFGELAATAVFVFIACMGCVETPLFQNSHFRSGLTFGLAILIAIQCFGSVSGAHLNPAITLAAWL 94
            |..|...|.||||......::......|..:..|||||.:...:|..|.:||||||||:|:|..:
 Frog    13 FVAEFLGTLVFVFFGLCSAMQWAPELPSVLQISLTFGLGVGTIVQAVGHISGAHLNPAVTIAFLV 77

  Fly    95 YGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCVTILAPGISVLQGVFIEFL 159
            ...|...||:.|..||..||::|..||....| .|:.|     ...|.:|:...:..|.|.:|.:
 Frog    78 ASQISLFRALCYICAQLLGAVVGAALLHEFTP-ESVHG-----NFGVNLLSNNTTEGQAVTVEMI 136

  Fly   160 ITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRSLGPAVWNDSWAHH 224
            :|..|::...:..|........|..:..||:|:...|....|||.||||.||.|||:...::..|
 Frog   137 LTLQLILCVFASTDSNRCDNVGSPSISIGLSVAVGHLVGIYFTGCSMNPARSFGPALIAGNFDAH 201

  Fly   225 WIYWVGPLVAGAVTSLIY--------------------RMAFKGDEEIDLR 255
            ||:|:||.....:.||:|                    ||..|.:||.:.|
 Frog   202 WIFWIGPFTGAIIASLLYNYVLCPQQQSFSEKLSILLGRMPDKEEEEWEER 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 73/233 (31%)
LOC100489792XP_002935778.1 MIP 3..219 CDD:333943 72/211 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.