DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and LOC100487834

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_017950427.1 Gene:LOC100487834 / 100487834 -ID:- Length:299 Species:Xenopus tropicalis


Alignment Length:237 Identity:87/237 - (36%)
Similarity:125/237 - (52%) Gaps:22/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GELAATAVFVFIA-----CMGCVETPLFQNSH-FRSGLTFGLAILIAIQCFGSVSGAHLNPAITL 90
            ||..|..:||.:.     ..|..::|  |.:. .|..|.|||:|:..:.|||.:||||||||:|:
 Frog    18 GEFIAMLIFVLLGLGSTISWGVGDSP--QPADLLRISLCFGLSIVTMVHCFGHISGAHLNPAVTI 80

  Fly    91 AAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCVTILAPGISVLQGVF 155
            |......|...:::.|.:||..||:.|.|||..:.|.|.|      ..:.||::...:|:..|:.
 Frog    81 AFVCTRRITLAKSLFYIIAQCLGAISGAGLLYIITPFNLI------GNLGVTMVNERLSLGHGLL 139

  Fly   156 IEFLITCCLVMVACSVWDPRNAKLQDSV-PVRFGLTVSCLILTAGLFTGASMNPTRSLGPAV--W 217
            :|.|||..||....:..||   |.:|.. |:..|::|....|.|..:|||||||.|||||||  |
 Frog   140 VEILITFQLVFCISASCDP---KYKDKYPPIAIGISVIIGHLFAINYTGASMNPARSLGPAVILW 201

  Fly   218 NDSWAHHWIYWVGPLVAGAVTSLIYRMAFKGDEEIDLRTSDA 259
            |  |..||||||||::.....:.:|...:..|.::.....:|
 Frog   202 N--WKSHWIYWVGPIIGAVCAATVYDYIYCPDNDLKQHLKEA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 85/220 (39%)
LOC100487834XP_017950427.1 MIP 9..224 CDD:333943 84/218 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.