DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and aqp4

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001304775.1 Gene:aqp4 / 100487371 XenbaseID:XB-GENE-487854 Length:345 Species:Xenopus tropicalis


Alignment Length:225 Identity:78/225 - (34%)
Similarity:114/225 - (50%) Gaps:10/225 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GELAATAVFVFIACMGCVETPLFQNSH----FRSGLTFGLAILIAIQCFGSVSGAHLNPAITLAA 92
            ||..|..:||.::....:......|..    ....|.|||:|...:||||.:||.|:|||:|:|.
 Frog    40 GEFLAMLIFVLLSLGSTINWSPKDNPQPADLVLIALCFGLSIATLVQCFGHISGGHINPAVTVAM 104

  Fly    93 WLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCVTILAPGISVLQGVFIE 157
            .....|...::|.|.|||..||:.|.|:|..|.|.      |....:..|::...:|...|:.:|
 Frog   105 VSMRKISLAKSIFYIVAQCLGAIAGAGILYLVTPS------DVAGNLGATMVNTKLSSAHGLLVE 163

  Fly   158 FLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRSLGPAVWNDSWA 222
            .:||..||...|:..||:...:..||.:..|.:|:...|.|..:|||||||.||.||||..:.|.
 Frog   164 LIITFQLVFTICASCDPKRKDISGSVALAIGFSVAIGHLFAIPYTGASMNPARSFGPAVIMNKWE 228

  Fly   223 HHWIYWVGPLVAGAVTSLIYRMAFKGDEEI 252
            .||:|||||::...:...:|...:..|.|:
 Frog   229 SHWVYWVGPVLGAVIAGALYEYVYCPDPEL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 76/215 (35%)
aqp4NP_001304775.1 MIP 31..248 CDD:278651 75/213 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.