DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and aqp8

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001107728.1 Gene:aqp8 / 100135726 XenbaseID:XB-GENE-481926 Length:269 Species:Xenopus tropicalis


Alignment Length:252 Identity:87/252 - (34%)
Similarity:131/252 - (51%) Gaps:17/252 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KQKSQESNPNARWRLEGHQRSAIACFFGELAATAVFVFIACMGCVETPLFQNSHFRSGLTFGLAI 69
            |:::.:.:|:  | .|.:.:..:|    ||..:|:|:|..|:..:|......| .:..|..|||:
 Frog    30 KEEAVDISPH--W-FETYVQPCVA----ELLGSALFIFAGCLSVIENASTTGS-LQPALAHGLAL 86

  Fly    70 LIAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVD 134
            .:.|...|.:||.|.|||::|||||.|.:..|..:.|:|.|..|.:||..|.:||   ::....:
 Frog    87 GLTIAVLGGISGGHFNPAVSLAAWLIGGLNIILLVPYWVCQLCGGMIGAALAMAV---SADTNFE 148

  Fly   135 NPSGVCVTILAPGISVLQGVFIEFLITCCLVMVAC--SVWDPRNAKLQDSVPVRFGLTVSCLILT 197
            |.:|...|.:....||.:.:..|.::|..||...|  ::.:.....|   .|...|.||:..||.
 Frog   149 NATGAAFTTVKNDESVARAIGAEIIMTFFLVFAVCMGAINEKSRTPL---APFCIGFTVTVDILA 210

  Fly   198 AGLFTGASMNPTRSLGPAVWNDSWAHHWIYWVGPLVAGAVTSLIYRMAFKGDEEIDL 254
            .|..:||.|||.|:.||||..|.|..|||||||||..|.:...|.|:.. ||::|.|
 Frog   211 GGAISGACMNPARAFGPAVVADYWTFHWIYWVGPLAGGLLVGGIIRLCL-GDKKIRL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 77/215 (36%)
aqp8NP_001107728.1 MIP 48..258 CDD:294134 79/220 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4373
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.