DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp3 and aqp10b

DIOPT Version :9

Sequence 1:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_005159449.1 Gene:aqp10b / 100034395 ZFINID:ZDB-GENE-060503-57 Length:309 Species:Danio rerio


Alignment Length:289 Identity:76/289 - (26%)
Similarity:122/289 - (42%) Gaps:49/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RWRLEGH-QRSAIACFFGELAATAVFVFIACMGCVETPLFQNSH---------FRSGLTFGLAIL 70
            |:|::.. .|..:|.|||    ..|.:...|....:....||:.         |..|.|||:.|.
Zfish     7 RYRIKSRLPRECLAEFFG----VYVLILFGCGSVAQVTTSQNTKGEYLSINLGFALGTTFGIYIA 67

  Fly    71 IAIQCFGSVSGAHLNPAITLAAWLYGAIGWIRAIAY--------FVAQAAGALIGYGLLVAVLPG 127
                  ..|||||||||::::..:.|...|.|...|        |:|.|..||..|..::....|
Zfish    68 ------KGVSGAHLNPAVSVSLCVLGRFSWTRLPFYVCSQLFGAFLAAATVALQYYDAIMDFTGG 126

  Fly   128 N-SIKGVDNPSGVCVTILAPGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSV-PVRFGLT 190
            : ::.|....:|:..|..|..:|:..||..:.:.|..|::...::.|..|......: ||..|..
Zfish   127 HLTVSGATATAGIFSTYPADYLSLWGGVVDQIIGTAALLVCVLALGDAHNTPAPAGLEPVLVGAA 191

  Fly   191 VSCLILTAGLFTGASMNPTRSLGP------AVWNDS---WAHHWIYWVGPLV---AGAVT-SLIY 242
            |..:.::.|..:|.::||.|..||      |.|.|.   ..|.| :|| |::   .||:. ||:|
Zfish   192 VLVIGISMGSNSGYAINPARDFGPRLFSYIAGWGDEVFRAGHGW-WWV-PIIVTCVGALLGSLLY 254

  Fly   243 RMAF----KGDEEIDLRTSDAKIRMIGEV 267
            .:..    ...|.:|.....|.::...|:
Zfish   255 ELLIGVHHPDSEAVDHEDPTAALQQTVEM 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp3NP_611812.2 MIP 30..244 CDD:294134 68/245 (28%)
aqp10bXP_005159449.1 MIP 5..247 CDD:294134 67/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573487
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.640

Return to query results.
Submit another query.