DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and AQY1

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_015518.1 Gene:AQY1 / 856322 SGDID:S000006396 Length:305 Species:Saccharomyces cerevisiae


Alignment Length:279 Identity:70/279 - (25%)
Similarity:117/279 - (41%) Gaps:54/279 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPVQQPQSAEIGHQMKMSSEEPPSGKQTCRSQSNCWLLQRRQLDSITTVLAEMIATAMLMFLGCM 65
            :|.:||::..  |:.|:|       :.|.|             |.....:.|...|  .|||.|.
Yeast    26 IPPEQPETKH--HRFKIS-------RDTLR-------------DHFIAAVGEFCGT--FMFLWCA 66

  Fly    66 GSVENSVFTNSD---------------FQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVYN 115
            ..:.|  ..|.|               ...|:.|||.|:..|.||..|.|..||||::|:..:..
Yeast    67 YVICN--VANHDVALVAAPDGSHPGQLIMIAIGFGFSVMFSIWCFAGVSGGALNPAMSLSLCLAR 129

  Fly   116 MISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLIT 180
            .:|....:..:|:|:|......|...|:.|...:::         .||....:..:||.:|...|
Yeast   130 AVSPTRCVVMWVSQIVAGMAAGGAASAMTPGEVLFA---------NSLGLGCSRTRGLFLEMFGT 185

  Fly   181 CVL-ISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPAIWNGFWDD-H 243
            .:| ::|.....:.|......:||:...|.||.::|||  .||..:||.||...|:...::.. |
Yeast   186 AILCLTVLMTAVEKRETNFMAALPIGISLFIAHVALTA--YTGTGVNPARSLGAAVAARYFPHYH 248

  Fly   244 WIYWVGPMAAALITSVIYK 262
            ||||:|.:..:::...:::
Yeast   249 WIYWIGTLLGSILAWSVWQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 62/236 (26%)
AQY1NP_015518.1 MIP 54..266 CDD:273306 61/226 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I1786
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I1546
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm13431
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.