DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and FPS1

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_013057.1 Gene:FPS1 / 850683 SGDID:S000003966 Length:669 Species:Saccharomyces cerevisiae


Alignment Length:239 Identity:70/239 - (29%)
Similarity:103/239 - (43%) Gaps:29/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SITTVLAEMIATAMLMFLGCMGSVENSVFTNSDFQSALNFGFVVLICIQCFG--CVCGAHLNPAV 107
            ::|...||.| .||......:.||....|.:    .||.:...|::...|.|  .:.||||||::
Yeast   296 NVTGSSAETI-DAMKSLTSLVSSVAGGTFDD----VALGWAAAVVMGYFCAGGSAISGAHLNPSI 355

  Fly   108 TLATYVYNMISLPMALAYFVAQMVGAFIGYGLL----KAVLPESAIYS----AENPNGVCLTSLN 164
            |||..||....|.....||..|::|||.|..:|    |.||.|:  ||    .|:..|:......
Yeast   356 TLANLVYRGFPLKKVPYYFAGQLIGAFTGALILFIWYKRVLQEA--YSDWWMNESVAGMFCVFPK 418

  Fly   165 STLTPWQGLAVEFLITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVR 229
            ..|:..:....|||...:|.:....:.||......|..|:...:.|..::.:....||.:||..|
Yeast   419 PYLSSGRQFFSEFLCGAMLQAGTFALTDPYTCLSSDVFPLMMFILIFIINASMAYQTGTAMNLAR 483

  Fly   230 SFAP--AIWN-GF-----WDDH----WIYWVGPMAAALITSVIY 261
            ...|  |::. ||     |..|    |:..|||...||:..::|
Yeast   484 DLGPRLALYAVGFDHKMLWVHHHHFFWVPMVGPFIGALMGGLVY 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 69/237 (29%)
FPS1NP_013057.1 MIP 244..527 CDD:395174 69/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341339
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm13431
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2121
SonicParanoid 1 1.000 - - X153
TreeFam 00.000 Not matched by this tool.
76.670

Return to query results.
Submit another query.