DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and YLL053C

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_013047.1 Gene:YLL053C / 850673 SGDID:S000003976 Length:152 Species:Saccharomyces cerevisiae


Alignment Length:137 Identity:36/137 - (26%)
Similarity:63/137 - (45%) Gaps:15/137 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 QMVGAFIGYGLLKAVLPESAIYSAENPNGV-CLTSLNSTLTPWQGLAVEFLITCVL-ISVCCGVW 191
            |::......|...|:.|...:::  |..|: |..|        :||.:|...|.|| ::|.....
Yeast     5 QIIAGMAAGGAASAMTPGKVLFT--NALGLGCSRS--------RGLFLEMFGTAVLCLTVLMTAV 59

  Fly   192 DPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPAIWNGFWDD-HWIYWVGPMAAAL 255
            :.|......:||:...|.:|.::||.  .||..:||.||...|:...::.. |||||:.|:..|.
Yeast    60 EKRETNFMAALPIGISLFMAHMALTG--YTGTGVNPARSLGAAVAARYFPHYHWIYWISPLLGAF 122

  Fly   256 ITSVIYK 262
            :...:::
Yeast   123 LAWSVWQ 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 36/134 (27%)
YLL053CNP_013047.1 MIP <1..133 CDD:412216 36/137 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I1786
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm13431
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.