DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and NIP6;1

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_178191.1 Gene:NIP6;1 / 844415 AraportID:AT1G80760 Length:305 Species:Arabidopsis thaliana


Alignment Length:295 Identity:84/295 - (28%)
Similarity:131/295 - (44%) Gaps:46/295 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GHQMKMSSEEPPSGKQTCR--SQSNCWLLQRRQLDSITTVL------------AEMIATAMLMFL 62
            ||..:.:   |.|..::|:  |..|.|.|:..:|..:|..|            ||.:.|.:|:|.
plant    34 GHNGRYT---PKSLLKSCKCFSVDNEWALEDGRLPPVTCSLPPPNVSLYRKLGAEFVGTLILIFA 95

  Fly    63 GCMGSVENSVFTNSD--FQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVYNMISLPMALAY 125
            |...::.|.....::  ...|.:.|..|:|.|...|.:.|||||||||:|.         .||.:
plant    96 GTATAIVNQKTDGAETLIGCAASAGLAVMIVILSTGHISGAHLNPAVTIAF---------AALKH 151

  Fly   126 FVAQMVGAFIGYGLLKAVLPESAIYSAENP---NGVCLTSLNSTLTPWQGLAVEFLITCVLISVC 187
            |..:.|..:||..::.:|....|:.:...|   .||.:.::..:    |..|:||:|:..|:.|.
plant   152 FPWKHVPVYIGAQVMASVSAAFALKAVFEPTMSGGVTVPTVGLS----QAFALEFIISFNLMFVV 212

  Fly   188 CGVWDPRNATKQDSLPVRFGLAIACL----SLTAGQLTGASMNPVRSFAPAIWNGFWDDHWIYWV 248
            ..|     ||...::....|:|:...    .|.||..|.|||||||:..|||....:...|:|..
plant   213 TAV-----ATDTRAVGELAGIAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYRAIWVYLT 272

  Fly   249 GPMAAALITSVIYKHAFRRELEESEVDETTMSTKR 283
            .|:..|||.:..|  ...:..||.|..:...|.:|
plant   273 APILGALIGAGTY--TIVKLPEEDEAPKERRSFRR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 69/240 (29%)
NIP6;1NP_178191.1 PLN00026 1..305 CDD:177663 83/293 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.