DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and TIP3;1

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_177462.1 Gene:TIP3;1 / 843653 AraportID:AT1G73190 Length:268 Species:Arabidopsis thaliana


Alignment Length:238 Identity:71/238 - (29%)
Similarity:110/238 - (46%) Gaps:32/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DSITTVLAEMIATAMLMFLGCMGSVENSVF--------------TNSD---FQSALNFGFVVLIC 91
            |||...|||.::|.:.:|     :.|.|:.              ||:.   ...||...|.:...
plant    21 DSIRATLAEFLSTFVFVF-----AAEGSILSLDKLYWEHAAHAGTNTPGGLILVALAHAFALFAA 80

  Fly    92 IQCFGCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPN 156
            :.....|.|.|:|||||....|...::...|:.|::||::||.:...||:...      :...|.
plant    81 VSAAINVSGGHVNPAVTFGALVGGRVTAIRAIYYWIAQLLGAILACLLLRLTT------NGMRPV 139

  Fly   157 GVCLTSLNSTLTPWQGLAVEFLITCVLISVCCG-VWDPRNATKQDSLPVRFGLAIACLSLTAGQL 220
            |..|.|....:   .||.:|.::|..|:.|... :.||:..:.....|:..||.:....|..|..
plant   140 GFRLASGVGAV---NGLVLEIILTFGLVYVVYSTLIDPKRGSLGIIAPLAIGLIVGANILVGGPF 201

  Fly   221 TGASMNPVRSFAPAIWNGFWDDHWIYWVGPMAAALITSVIYKH 263
            :||||||.|:|.||:....|.|||||||||...:.:.::||::
plant   202 SGASMNPARAFGPALVGWRWHDHWIYWVGPFIGSALAALIYEY 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 69/234 (29%)
TIP3;1NP_177462.1 MIP 11..268 CDD:412216 71/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.