DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and NIP3;1

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_174472.2 Gene:NIP3;1 / 840079 AraportID:AT1G31885 Length:323 Species:Arabidopsis thaliana


Alignment Length:264 Identity:72/264 - (27%)
Similarity:111/264 - (42%) Gaps:49/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ITTVLAEMIATAMLMFLGCMGSVENSVFTNSDFQS--ALNFGFVVLICIQCFGCVCGAHLNPAVT 108
            :..::.|.:.|..::|.||...|.|..:.......  ||.:|.||.:.|...|.|.|||.||||:
plant    42 VQKLIGEFVGTFTMIFAGCSAIVVNETYGKPVTLPGIALVWGLVVTVMIYSIGHVSGAHFNPAVS 106

  Fly   109 LA-----TYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLP--------ESAIYSAENPNGVCL 160
            :|     .:.:|.:.     .|..||::|:.:...:|:.|..        :..:|....|:    
plant   107 IAFASSKKFPFNQVP-----GYIAAQLLGSTLAAAVLRLVFHLDDDVCSLKGDVYVGTYPS---- 162

  Fly   161 TSLNSTLTPWQGLAVEFLITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASM 225
               ||..|   ...:||:.|..|:.|...|...:.||...: .:..|..|....|.:|.::||||
plant   163 ---NSNTT---SFVMEFIATFNLMFVISAVATDKRATGSFA-GIAIGATIVLDILFSGPISGASM 220

  Fly   226 NPVRSFAPAIWNGFWDDHWIYWVGPMAAAL----------ITSVIYKHAFR--------RELEES 272
            ||.||..||:..|.:.|.|:|.|.|:..||          .|...|....|        |:.:|:
plant   221 NPARSLGPALIWGCYKDLWLYIVSPVIGALSGAWTYGLLRSTKKSYSEIIRPNCNKVSSRDRQEA 285

  Fly   273 EVDE 276
            ..||
plant   286 SQDE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 66/239 (28%)
NIP3;1NP_174472.2 MIP 37..271 CDD:294134 67/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.