DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and BETA-TIP

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_173223.1 Gene:BETA-TIP / 838359 AraportID:AT1G17810 Length:267 Species:Arabidopsis thaliana


Alignment Length:234 Identity:73/234 - (31%)
Similarity:111/234 - (47%) Gaps:24/234 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DSITTVLAEMIATAMLMFLGCMGSV--------ENSVFTNSDFQS-----ALNFGFVVLICIQCF 95
            |||...|||.::|.:.:|.| .||:        :.:..|.::...     ||.....:...:...
plant    21 DSIRATLAEFLSTFVFVFAG-EGSILALDKLYWDTAAHTGTNTPGGLVLVALAHALALFAAVSAA 84

  Fly    96 GCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCL 160
            ..|.|.|:|||||.|..:...||:..|:.|:|||::||.:...||:...      :...|.|..:
plant    85 INVSGGHVNPAVTFAALIGGRISVIRAIYYWVAQLIGAILACLLLRLAT------NGLRPVGFHV 143

  Fly   161 TSLNSTLTPWQGLAVEFLITCVLISVCCG-VWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGAS 224
            .|..|.|   .||.:|.::|..|:.|... ..||:..:.....|:..||.:....|..|...|||
plant   144 ASGVSEL---HGLLMEIILTFALVYVVYSTAIDPKRGSIGIIAPLAIGLIVGANILVGGPFDGAS 205

  Fly   225 MNPVRSFAPAIWNGFWDDHWIYWVGPMAAALITSVIYKH 263
            |||.|:|.||:....|.:||||||||.....:.::||::
plant   206 MNPARAFGPALVGWRWSNHWIYWVGPFIGGALAALIYEY 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 71/230 (31%)
BETA-TIPNP_173223.1 MIP 11..267 CDD:412216 73/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.