DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and PIP2;4

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_200874.1 Gene:PIP2;4 / 836187 AraportID:AT5G60660 Length:291 Species:Arabidopsis thaliana


Alignment Length:274 Identity:76/274 - (27%)
Similarity:118/274 - (43%) Gaps:32/274 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EIGHQMKMSSEEPPSGKQTCRSQSNCWLLQRRQLDSITTVLAEMIATAMLMFLGCMGSVENSVFT 74
            |.|.......::||........:...|.|.|       .|:||.:||.:.:::..:..:.....|
plant     9 ESGPPAARDYKDPPPAPFFDMEELRKWPLYR-------AVIAEFVATLLFLYVSILTVIGYKAQT 66

  Fly    75 NSD-----------FQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVYNMISLPMALAYFVA 128
            ::.           ...|..||.::.:.:.|...:.|.|:|||||:..::...:||...:.|.||
plant    67 DATAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARKVSLVRTVLYIVA 131

  Fly   129 QMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLITCVLISVCCGVWDP 193
            |.:||..|.|.:||.  :|:.|:.   .|.....|........||..|.:.|.||:.......||
plant   132 QCLGAICGCGFVKAF--QSSYYTR---YGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDP 191

  Fly   194 RNATKQDSLPV----RFGLAIACLSLTAGQLTGASMNPVRSF-APAIWNG--FWDDHWIYWVGPM 251
            :...:...:||    ..|.|:..:.|....:||..:||.||| |..|:|.  .|||.||:|||||
plant   192 KRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPM 256

  Fly   252 AAALITSVIYKHAF 265
            ..|  .:..:.|.|
plant   257 IGA--AAAAFYHQF 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 67/237 (28%)
PIP2;4NP_200874.1 MIP 31..266 CDD:395174 70/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.