DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and TIP2;3

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_199556.1 Gene:TIP2;3 / 834794 AraportID:AT5G47450 Length:250 Species:Arabidopsis thaliana


Alignment Length:242 Identity:69/242 - (28%)
Similarity:109/242 - (45%) Gaps:17/242 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LDSITTVLAEMIATAMLMFLGCMGSVENSVFTNSD-------FQSALNFGFVVLICIQCFGCVCG 100
            :.|:...|:|.|||.:.:|.|...:|..:..|:..       ...|:...|.:.:.:.....:.|
plant    15 VSSLKAYLSEFIATLLFVFAGVGSAVAFAKLTSDGALDPAGLVAIAIAHAFALFVGVSIAANISG 79

  Fly   101 AHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNS 165
            .||||||||...:...|:|.....|::||.:|:.:...||..|         .|...|....:::
plant    80 GHLNPAVTLGLAIGGNITLITGFFYWIAQCLGSIVACLLLVFV---------TNGKSVPTHGVSA 135

  Fly   166 TLTPWQGLAVEFLITCVLI-SVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVR 229
            .|...:|:.:|.::|..|: :|.....||:..:.....|:..|..:....|.||..:|.||||.|
plant   136 GLGAVEGVVMEIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPAR 200

  Fly   230 SFAPAIWNGFWDDHWIYWVGPMAAALITSVIYKHAFRRELEESEVDE 276
            ||.||:.:|.....|||||||:....:..:||...|....|..|..|
plant   201 SFGPAVVSGDLSQIWIYWVGPLVGGALAGLIYGDVFIGSYEAVETRE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 63/225 (28%)
TIP2;3NP_199556.1 PLN00166 1..250 CDD:165733 69/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.