DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and NIP4;1

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_198597.1 Gene:NIP4;1 / 833759 AraportID:AT5G37810 Length:283 Species:Arabidopsis thaliana


Alignment Length:279 Identity:76/279 - (27%)
Similarity:122/279 - (43%) Gaps:35/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QSAEIGHQMKMSSEEPPSGKQT--CRSQSNCWLLQRRQLDSITTVLAEMIATAMLMFLGCMGSVE 69
            :..:|....|...::...|.:|  |.|.|...|.|:        ::||||.|..::|.||...|.
plant     9 EEEQISRIEKGKGKDCQGGIETVICTSPSIVCLTQK--------LIAEMIGTYFIVFSGCGVVVV 65

  Fly    70 NSVFTNS-DFQS-ALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVG 132
            |.::..: .|.. .:.:|.:|::.|...|.:.|||.|||||:...::..........|..||..|
plant    66 NVLYGGTITFPGICVTWGLIVMVMIYSTGHISGAHFNPAVTVTFAIFRRFPWHQVPLYIGAQFAG 130

  Fly   133 AFIG---YGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLITCVLISVCCGVWDPR 194
            :.:.   ..|:..|.||:  :....|..          :|.:.|..|.:|:.:|:.|..||....
plant   131 SLLASLTLRLMFKVTPEA--FFGTTPAD----------SPARALVAEIIISFLLMFVISGVATDN 183

  Fly   195 NATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPAIWNGFWDDHWIYWVGPMAAALITSV 259
            .|. .:...:..|:.|......||.::||||||.||..||:..|.:...|:|.|||:...:....
plant   184 RAV-GELAGIAVGMTIMVNVFVAGPISGASMNPARSLGPALVMGVYKHIWVYIVGPVLGVISGGF 247

  Fly   260 IYKHAFR------RELEES 272
            :| :..|      |||.:|
plant   248 VY-NLIRFTDKPLRELTKS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 61/224 (27%)
NIP4;1NP_198597.1 PLN00182 1..283 CDD:165748 76/279 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.