DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and PIP3

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001190920.1 Gene:PIP3 / 829662 AraportID:AT4G35100 Length:280 Species:Arabidopsis thaliana


Alignment Length:273 Identity:71/273 - (26%)
Similarity:114/273 - (41%) Gaps:54/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EPPSGKQTCRSQSNCWLLQRRQLDSITTVLAEMIATAMLMF------------------LGCMGS 67
            :||........:...|...|       .::||.|||.:.::                  :|.:| 
plant    19 DPPPAPLLDMGELKSWSFYR-------ALIAEFIATLLFLYVTVATVIGHKKQTGPCDGVGLLG- 75

  Fly    68 VENSVFTNSDFQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVG 132
                        .|..||.::.:.:.|...:.|.|:|||||...::...:||..||.|.:||.:|
plant    76 ------------IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALGYMIAQCLG 128

  Fly   133 AFIGYGLLKAVL--PESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLITCVLISVCCGVWDPRN 195
            |..|.|.:||.:  |.:.:....|       ::....:....|..|.:.|.||:.......||:.
plant   129 AICGVGFVKAFMKTPYNTLGGGAN-------TVADGYSKGTALGAEIIGTFVLVYTVFSATDPKR 186

  Fly   196 ATKQDSLPV----RFGLAIACLSLTAGQLTGASMNPVRSF-APAIWNG--FWDDHWIYWVGPMAA 253
            :.:...:||    ..|.|:..:.|....:||..:||.||| |..|:|.  .|||.||:||||...
plant   187 SARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLG 251

  Fly   254 ALITSVIYKHAFR 266
            ||..:..:::..|
plant   252 ALAAAAYHQYILR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 66/246 (27%)
PIP3NP_001190920.1 MIP 30..259 CDD:395174 68/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.