DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and TIP1;3

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_192056.1 Gene:TIP1;3 / 828051 AraportID:AT4G01470 Length:252 Species:Arabidopsis thaliana


Alignment Length:232 Identity:68/232 - (29%)
Similarity:108/232 - (46%) Gaps:21/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DSITTVLAEMIATAMLMFLGCMGSVENSVFTNSD-------FQSALNFGFVVLICIQCFGCVCGA 101
            |:|....||..:..:.:|.|....:.....|...       ..::|:..|.:.:.:.....|.|.
plant    18 DAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPAGLVAASLSHAFALFVAVSVGANVSGG 82

  Fly   102 HLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVL--PESAIYSAENPNGVCLTSLN 164
            |:|||||...::...|:|..|:.|::||::||.:...|||...  .|:|.:           ||:
plant    83 HVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLLLKVSTGGMETAAF-----------SLS 136

  Fly   165 STLTPWQGLAVEFLITCVLI-SVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPV 228
            ..:|||..:..|.::|..|: :|.....||:........|:..||.:....|..|...||||||.
plant   137 YGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVGANILVGGAFDGASMNPA 201

  Fly   229 RSFAPAIWNGFWDDHWIYWVGPMAAALITSVIYKHAF 265
            .||.||:.:..|.:||:|||||...|.|.:::|...|
plant   202 VSFGPAVVSWIWTNHWVYWVGPFIGAAIAAIVYDTIF 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 66/226 (29%)
TIP1;3NP_192056.1 PLN00027 1..252 CDD:177664 68/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.