DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and NIP1;2

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_193626.1 Gene:NIP1;2 / 827626 AraportID:AT4G18910 Length:294 Species:Arabidopsis thaliana


Alignment Length:260 Identity:72/260 - (27%)
Similarity:116/260 - (44%) Gaps:33/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QMKMSSEEPPSGKQTCRSQSNCWLLQRRQLDSITTVLAEMIATAMLMFLGCMGSVENSVFTNSDF 78
            |.:..:...|..||......:...||:        ::||::.|..|:|.||.     :|..|:..
plant    27 QQQQQAIHKPLKKQDSLLSISVPFLQK--------LMAEVLGTYFLIFAGCA-----AVAVNTQH 78

  Fly    79 QSALN-------FGFVVLICIQCFGCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIG 136
            ..|:.       :|..|::.:...|.:.|||.|||||:|........|....||.::|::|:.:.
plant    79 DKAVTLPGIAIVWGLTVMVLVYSLGHISGAHFNPAVTIAFASCGRFPLKQVPAYVISQVIGSTLA 143

  Fly   137 YGLLKAVLP-ESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLITCVLISVCCGVWDPRNATKQD 200
            ...|:.:.. :..:.|.::...|......|.|   |...:||:||..|:.|..||     ||...
plant   144 AATLRLLFGLDQDVCSGKHDVFVGTLPSGSNL---QSFVIEFIITFYLMFVISGV-----ATDNR 200

  Fly   201 SLPVRFGLAIACLSL----TAGQLTGASMNPVRSFAPAIWNGFWDDHWIYWVGPMAAALITSVIY 261
            ::....|||:....|    .||.::||||||.||..||:....:...|||.|.|:..|:..:.:|
plant   201 AIGELAGLAVGSTVLLNVIIAGPVSGASMNPGRSLGPAMVYSCYRGLWIYIVSPIVGAVSGAWVY 265

  Fly   262  261
            plant   266  265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 65/231 (28%)
NIP1;2NP_193626.1 PLN00184 1..293 CDD:177778 72/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.