DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and PIP2A

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001030851.1 Gene:PIP2A / 824510 AraportID:AT3G53420 Length:287 Species:Arabidopsis thaliana


Alignment Length:265 Identity:79/265 - (29%)
Similarity:124/265 - (46%) Gaps:30/265 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EEPPSGKQTCRSQSNCWLLQRRQLDSITTVLAEMIATAMLMFLGCMGSVENSVFTNSD------- 77
            ::||.......::...|...|       .|:||.:||.:.:::..:..:...:.:::|       
plant    19 QDPPPAPFIDGAELKKWSFYR-------AVIAEFVATLLFLYITVLTVIGYKIQSDTDAGGVDCG 76

  Fly    78 ----FQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYG 138
                ...|..||.::.|.:.|...:.|.|:|||||...::...:|||.||.|.:||.:||..|.|
plant    77 GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLPRALLYIIAQCLGAICGVG 141

  Fly   139 LLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLITCVLISVCCGVWDPRNATKQDSLP 203
            .:||.  :|:.|:........|....||.|   |||.|.:.|.||:.......||:.:.:...:|
plant   142 FVKAF--QSSYYTRYGGGANSLADGYSTGT---GLAAEIIGTFVLVYTVFSATDPKRSARDSHVP 201

  Fly   204 V----RFGLAIACLSLTAGQLTGASMNPVRSF-APAIWNGF--WDDHWIYWVGPMAAALITSVIY 261
            |    ..|.|:..:.|....:||..:||.||| |..|:|..  ||||||:||||...|.|.:..:
plant   202 VLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYH 266

  Fly   262 KHAFR 266
            :...|
plant   267 QFVLR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 74/237 (31%)
PIP2ANP_001030851.1 MIP 31..266 CDD:395174 76/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.