DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and TIP2

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_189283.1 Gene:TIP2 / 822259 AraportID:AT3G26520 Length:253 Species:Arabidopsis thaliana


Alignment Length:242 Identity:67/242 - (27%)
Similarity:110/242 - (45%) Gaps:17/242 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DSITTVLAEMIATAMLMFLGCMGSV------ENSVFTNSDF-QSALNFGFVVLICIQCFGCVCGA 101
            :::...|||.|:|.:.:|.|....:      :|...|.|.. .:||...|.:.:.:.....:.|.
plant    19 NALRAALAEFISTLIFVFAGSGSGIAFNKITDNGATTPSGLVAAALAHAFGLFVAVSVGANISGG 83

  Fly   102 HLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNST 166
            |:|||||....:...|:|...:.|::||::|:.....||........|.:.....||  .|||: 
plant    84 HVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAFGLSAGV--GSLNA- 145

  Fly   167 LTPWQGLAVEFLITCVLI-SVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRS 230
                  |..|.::|..|: :|.....||:|.:.....|:..|..:....|..|..:||||||..:
plant   146 ------LVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVA 204

  Fly   231 FAPAIWNGFWDDHWIYWVGPMAAALITSVIYKHAFRRELEESEVDET 277
            |.||:.:..|.:||:||.||:....:..:||...|..|....::..|
plant   205 FGPAVVSWTWTNHWVYWAGPLIGGGLAGIIYDFVFIDENAHEQLPTT 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 62/224 (28%)
TIP2NP_189283.1 PLN00027 1..253 CDD:177664 67/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.