DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and NIP7;1

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_566271.1 Gene:NIP7;1 / 819783 AraportID:AT3G06100 Length:275 Species:Arabidopsis thaliana


Alignment Length:236 Identity:63/236 - (26%)
Similarity:109/236 - (46%) Gaps:40/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LDSITTVLAEMIATAMLMFLGCMGSVENSVFTNSD---FQSALNFGFVVLICIQCFGCVCGAHLN 104
            |:.:..|:||::.|.:|||..| |.:.::..:...   .:.|:..|..|::.:...|.:.|||||
plant    42 LNPLRIVMAELVGTFILMFSVC-GVISSTQLSGGHVGLLEYAVTAGLSVVVVVYSIGHISGAHLN 105

  Fly   105 PAVTLATYVYNMISLPMALAYFVAQMVGA----FIG---YGLLKAVLPESAIYSAENPNGVCLTS 162
            |::|:|..|:..........|..||.:||    .:|   ||:       :|...|..|...|:::
plant   106 PSITIAFAVFGGFPWSQVPLYITAQTLGATAATLVGVSVYGV-------NADIMATKPALSCVSA 163

  Fly   163 LNSTLTPWQGLAVEFLITCVLI----SVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGA 223
                      ..||.:.|.:::    ::.||  ..:|........:  |..|:...|..|.::|.
plant   164 ----------FFVELIATSIVVFLASALHCG--PHQNLGNLTGFVI--GTVISLGVLITGPISGG 214

  Fly   224 SMNPVRSFAPAI--WNGFWDDHWIYWVGPMAAALITSVIYK 262
            ||||.||..||:  |:  ::|.|||...|:..|:|..:.|:
plant   215 SMNPARSLGPAVVAWD--FEDLWIYMTAPVIGAIIGVLTYR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 62/233 (27%)
NIP7;1NP_566271.1 PLN00183 1..275 CDD:215092 63/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.