DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and PIP1B

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001078067.1 Gene:PIP1B / 819204 AraportID:AT2G45960 Length:301 Species:Arabidopsis thaliana


Alignment Length:270 Identity:80/270 - (29%)
Similarity:115/270 - (42%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PVQQPQSAEIG--HQMKMSSEEPPSGKQTCRSQSNCWLLQRRQLDSITTVLAEMIATAMLMF--- 61
            |.:||    ||  .|.....:|||........:...|...|       ..:||.|||.:.::   
plant    16 PERQP----IGTSAQSDKDYKEPPPAPLFEPGELASWSFWR-------AGIAEFIATFLFLYITV 69

  Fly    62 LGCMGSVENS--VFTNSDFQS-ALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVYNMISLPMAL 123
            |..|| |:.|  :..:...|. |..||.::...:.|...:.|.|:|||||...::...:||..|:
plant    70 LTVMG-VKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAV 133

  Fly   124 AYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLITCVLISVCC 188
            .|.|.|.:||..|.|::|...|:.  |.|   .|....::....|...||..|.:.|.||:....
plant   134 YYIVMQCLGAICGAGVVKGFQPKQ--YQA---LGGGANTIAHGYTKGSGLGAEIIGTFVLVYTVF 193

  Fly   189 GVWD-PRNATKQDS-----LPVRFGLAIACLSLTAGQLTGASMNPVRSFAPAI---WNGFWDDH- 243
            ...| .|||  :||     .|:..|.|:..:.|....:||..:||.||...||   .:..|||| 
plant   194 SATDAKRNA--RDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNKDNAWDDHV 256

  Fly   244 -----W-IYW 247
                 | |:|
plant   257 MGLLGWTIHW 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 69/229 (30%)
PIP1BNP_001078067.1 MIP 44..261 CDD:278651 68/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.