DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and PIP2B

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001323849.1 Gene:PIP2B / 818293 AraportID:AT2G37170 Length:328 Species:Arabidopsis thaliana


Alignment Length:284 Identity:84/284 - (29%)
Similarity:128/284 - (45%) Gaps:39/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VQQPQSAEIGHQMKMSSEEPPSGKQTCRSQSNCWLLQRRQLDSITTVLAEMIATAMLMFLGCMGS 67
            |:.|:    |.|.: ..|:||........:...|.|.|       .|:||.:||.:.:::..:..
plant    48 VEGPE----GFQTR-DYEDPPPTPFFDADELTKWSLYR-------AVIAEFVATLLFLYITVLTV 100

  Fly    68 VENSVFTNSDFQS-------------ALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVYNMISL 119
            :...:  .||.::             |..||.::.|.:.|...:.|.|:|||||...::...:||
plant   101 IGYKI--QSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL 163

  Fly   120 PMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLITCVLI 184
            ..|:.|.|||.:||..|.|.:||.  :|:.|.........|....:|.|   |||.|.:.|.||:
plant   164 IRAVLYMVAQCLGAICGVGFVKAF--QSSYYDRYGGGANSLADGYNTGT---GLAAEIIGTFVLV 223

  Fly   185 SVCCGVWDPRNATKQDSLPV----RFGLAIACLSLTAGQLTGASMNPVRSF-APAIWNGF--WDD 242
            .......||:...:...:||    ..|.|:..:.|....:||..:||.||| |..|:|..  |||
plant   224 YTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKSKPWDD 288

  Fly   243 HWIYWVGPMAAALITSVIYKHAFR 266
            |||:||||...|.|.:..::...|
plant   289 HWIFWVGPFIGAAIAAFYHQFVLR 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 73/239 (31%)
PIP2BNP_001323849.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.