DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and GAMMA-TIP

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_181221.1 Gene:GAMMA-TIP / 818255 AraportID:AT2G36830 Length:251 Species:Arabidopsis thaliana


Alignment Length:231 Identity:66/231 - (28%)
Similarity:110/231 - (47%) Gaps:19/231 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DSITTVLAEMIATAMLMFLGCMGS-------VENSVFTNSDF-QSALNFGFVVLICIQCFGCVCG 100
            |::...|||.|:|.:.:..| .||       .||...|.|.. .:|:...|.:.:.:.....:.|
plant    18 DALKAALAEFISTLIFVVAG-SGSGMAFNKLTENGATTPSGLVAAAVAHAFGLFVAVSVGANISG 81

  Fly   101 AHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNS 165
            .|:|||||...::...|:|...:.|::||::|:.:...:||......|:.:.....||.:  ||:
plant    82 GHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLILKFATGGLAVPAFGLSAGVGV--LNA 144

  Fly   166 TLTPWQGLAVEFLITCVLI-SVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVR 229
                   ...|.::|..|: :|.....||:|.:.....|:..|..:....|..|..:||||||..
plant   145 -------FVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAV 202

  Fly   230 SFAPAIWNGFWDDHWIYWVGPMAAALITSVIYKHAF 265
            :|.||:.:..|.:||:||.||:....|..:||:..|
plant   203 AFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFF 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 63/225 (28%)
GAMMA-TIPNP_181221.1 PLN00027 1..251 CDD:177664 66/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.