DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and NIP2;1

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_180986.1 Gene:NIP2;1 / 818002 AraportID:AT2G34390 Length:288 Species:Arabidopsis thaliana


Alignment Length:287 Identity:80/287 - (27%)
Similarity:128/287 - (44%) Gaps:44/287 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KMSSEEPPSGKQTCRSQSNCWLLQRRQLDSITTVLAEMIATAMLMFLGC----MGSVENSVFTNS 76
            |..|..||             ||....|..:   |||::.|..|:|.||    :.:..|.|.|..
plant    33 KHESSSPP-------------LLSVHFLQKL---LAELVGTYYLIFAGCAAIAVNAQHNHVVTLV 81

  Fly    77 DFQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLK 141
            ..  |:.:|.|:::.:.|.|.: .||.|||||||........|....||...|::|:.:....|:
plant    82 GI--AVVWGIVIMVLVYCLGHL-SAHFNPAVTLALASSQRFPLNQVPAYITVQVIGSTLASATLR 143

  Fly   142 AVL--------PESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLITCVLISVCCGVWDPRNATK 198
            .:.        .:..::...:|:|..|          |...:||:||..|:.|.|.|...:..|:
plant   144 LLFDLNNDVCSKKHDVFLGSSPSGSDL----------QAFVMEFIITGFLMLVVCAVTTTKRTTE 198

  Fly   199 Q-DSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPAIWNGFWDDHWIYWVGPMAAALITSVIYK 262
            : :.|.:  |..:....:.||:::||||||.||..||:..|.:...|||.:.|...|:..::|:|
plant   199 ELEGLII--GATVTLNVIFAGEVSGASMNPARSIGPALVWGCYKGIWIYLLAPTLGAVSGALIHK 261

  Fly   263 HAFRRELEESEVDETTMSTKRTSEAEL 289
            .....:..|.|..:|..|.||.::..|
plant   262 MLPSIQNAEPEFSKTGSSHKRVTDLPL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 65/232 (28%)
NIP2;1NP_180986.1 MIP 6..283 CDD:412216 78/280 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.