DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and AT2G29870

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_180548.1 Gene:AT2G29870 / 817537 AraportID:AT2G29870 Length:139 Species:Arabidopsis thaliana


Alignment Length:140 Identity:42/140 - (30%)
Similarity:67/140 - (47%) Gaps:13/140 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 SAENPNGVCLTSLNSTLTPWQGLAVEFLITCVLISVCCGVWDPRNATKQ-DSLPVRFGLAIACLS 214
            |..:|:|..|          |...:||:||..|:.|.|.|...:..|:: :.|.:  |..:....
plant    12 SGSSPSGSDL----------QAFVMEFIITGFLMLVVCAVTTTKRTTEELEGLII--GATVTLNV 64

  Fly   215 LTAGQLTGASMNPVRSFAPAIWNGFWDDHWIYWVGPMAAALITSVIYKHAFRRELEESEVDETTM 279
            :..|:::||||||.||..||:..|.:...|||.:.|...|:..::|:|........|.:..:|..
plant    65 IFVGEVSGASMNPARSIGPALVWGCYKGIWIYLLAPTLGAVSRALIHKMLPSIPNAEPKFSKTGS 129

  Fly   280 STKRTSEAEL 289
            |.||.|:..|
plant   130 SHKRVSDLPL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 33/110 (30%)
AT2G29870NP_180548.1 MIP <20..134 CDD:294134 36/125 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.