DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and TIP4;1

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_180152.1 Gene:TIP4;1 / 817123 AraportID:AT2G25810 Length:249 Species:Arabidopsis thaliana


Alignment Length:226 Identity:72/226 - (31%)
Similarity:113/226 - (50%) Gaps:17/226 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DSITTVLAEMIATAMLMFLGCMGS--VENSVFTNS---DFQSALNFGFVVLICIQCFGCVCGAHL 103
            |.|..::.|.|.|.:.:|.| :||  ..:|:..|:   .|..|:...|||.:.|.. |.:.|.||
plant    16 DCIKALIVEFITTFLFVFAG-VGSAMATDSLVGNTLVGLFAVAVAHAFVVAVMISA-GHISGGHL 78

  Fly   104 NPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLT 168
            ||||||...:...||:..|..|::.|::.:.....||..:         ....|..:.:|.|.::
plant    79 NPAVTLGLLLGGHISVFRAFLYWIDQLLASSAACFLLSYL---------TGGMGTPVHTLASGVS 134

  Fly   169 PWQGLAVEFLIT-CVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFA 232
            ..||:..|.::| .:|.:|...:.||:..:.....|:..|..:....|..|..:||||||.|||.
plant   135 YTQGIIWEIILTFSLLFTVYATIVDPKKGSLDGFGPLLTGFVVGANILAGGAFSGASMNPARSFG 199

  Fly   233 PAIWNGFWDDHWIYWVGPMAAALITSVIYKH 263
            ||:.:|.|.|||:|||||:....:...||::
plant   200 PALVSGNWTDHWVYWVGPLIGGGLAGFIYEN 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 70/222 (32%)
TIP4;1NP_180152.1 MIP 1..234 CDD:350945 72/226 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.