DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and PIP2;8

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_179277.1 Gene:PIP2;8 / 816186 AraportID:AT2G16850 Length:278 Species:Arabidopsis thaliana


Alignment Length:288 Identity:80/288 - (27%)
Similarity:125/288 - (43%) Gaps:56/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SAEIGHQMKMSSE--EPPSGKQTCRSQSNCWLLQRRQLDSITTVLAEMIATAMLMF--------- 61
            |.|:..:.:...:  :||.......::...|...|       .::||.|||.:.::         
plant     2 SKEVSEEGRHGKDYVDPPPAPLLDMAELKLWSFYR-------AIIAEFIATLLFLYVTVATVIGH 59

  Fly    62 ---------LGCMGSVENSVFTNSDFQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVYNMI 117
                     :|.:|             .|..||.::.:.:.|...:.|.|:|||||...::...:
plant    60 KNQTGPCGGVGLLG-------------IAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV 111

  Fly   118 SLPMALAYFVAQMVGAFIGYGLLKAVL--PESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLIT 180
            |||.|:||.|||.:||..|.||:||.:  |...:....|    .:....||.|   .|..|.:.|
plant   112 SLPRAVAYMVAQCLGAICGVGLVKAFMMTPYKRLGGGAN----TVADGYSTGT---ALGAEIIGT 169

  Fly   181 CVLISVCCGVWDPRNATKQDSLPV----RFGLAIACLSLTAGQLTGASMNPVRSF-APAIWNG-- 238
            .||:.......||:.:.:...:||    ..|.|:..:.|....:||..:||.||| |..|:|.  
plant   170 FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEK 234

  Fly   239 FWDDHWIYWVGPMAAALITSVIYKHAFR 266
            .||||||:||||...||..:..:::..|
plant   235 AWDDHWIFWVGPFVGALAAAAYHQYILR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 73/246 (30%)
PIP2;8NP_179277.1 MIP 28..257 CDD:395174 75/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.