DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and Aqp9

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_075249.1 Gene:Aqp9 / 65054 RGDID:68433 Length:295 Species:Rattus norvegicus


Alignment Length:270 Identity:78/270 - (28%)
Similarity:114/270 - (42%) Gaps:40/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PSGKQTCRSQSNCWLLQRRQLDS--ITTVLAEMIATAMLMFLGCMGSVENSVFTNSDFQS--ALN 83
            ||.|...:..    |:||..|.|  ....|:|.:.|.:::.||| .|:..:|.:...|..  .:|
  Rat     2 PSEKDGAKKS----LMQRLALKSRIAKETLSEFLGTFIMIVLGC-SSIAQAVLSRERFGGIITIN 61

  Fly    84 FGF---VVLICIQCFGCVCGAHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIG--------Y 137
            .||   ||:.....|| :.|.|:||||:.|...:..:.......|..||.:|||:|        |
  Rat    62 IGFASAVVMALYVTFG-ISGGHINPAVSFAMCAFGRMEWFKFPFYVGAQFLGAFVGAATVFGIYY 125

  Fly   138 GLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLI-TCVLISVCCGVWDPRNATKQDS 201
            ..|.|......:...||.......:..:......|..|:.:: |..|:.:...::|.||......
  Rat   126 DGLMAFAGGKLLVVGENATAFIFATYPAPFISTPGAFVDQVVSTMFLLLIVFAMFDSRNLGVPRG 190

  Fly   202 L-PVRFGLAIACLSLTAGQLTGASMNPVRSFAPAI------W--------NGFWDDHWIYWVGPM 251
            | ||..||.|..||.:.|..:|.:|||.|..:|.:      |        |.||   ||..||||
  Rat   191 LEPVVIGLLIIVLSCSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFTVGNNFW---WIPVVGPM 252

  Fly   252 AAALITSVIY 261
            ..|.:..:||
  Rat   253 IGAFLGGLIY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 70/250 (28%)
Aqp9NP_075249.1 MIP 4..266 CDD:412216 76/268 (28%)
NPA 1. /evidence=ECO:0000250|UniProtKB:Q96PS8 84..86 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:Q96PS8 216..218 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.