DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and aqp9b

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001171215.1 Gene:aqp9b / 570191 ZFINID:ZDB-GENE-070911-1 Length:291 Species:Danio rerio


Alignment Length:260 Identity:74/260 - (28%)
Similarity:111/260 - (42%) Gaps:60/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DSITTVLAEMIATAMLMFLGCMGSVENSVFTNSDFQSAL--NFGFV--VLICIQCFGCVCGAHLN 104
            |.|...|||::.|.:|:..|| |||..:|.:.......|  :|||.  |::.:...|.|.|.|:|
Zfish    19 DIIREFLAELLGTFVLILFGC-GSVAQTVLSREAKGQLLTIHFGFTLGVMLAVYMAGGVSGGHVN 82

  Fly   105 PAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYS------AENPNG-VCLTS 162
            |||:||..|...:.|.....|.:||.:|||.|         ..|:|.      .|..|| :.:|.
Zfish    83 PAVSLAMVVLRKLPLKKFPVYVLAQFLGAFFG---------SCAVYCLYYDAFTEFANGELAVTG 138

  Fly   163 LNSTL-----TPWQGLAV-----------EFLITCVLISVCCGVWDPRNATKQDSL-PVRFGLAI 210
            .|.|.     .|.:||::           ..|:.|:|     .|.|.:|......: |:..||:|
Zfish   139 PNVTAGIFASYPREGLSLLNGFIDQVIGAGALVLCIL-----AVVDKKNIGAPKGMEPLLVGLSI 198

  Fly   211 ACLSLTAGQLTGASMNPVRSFAPAI------W--------NGFWDDHWIYWVGPMAAALITSVIY 261
            ..:.::.....|..:||.|...|.:      |        ||:|   |:..||||...::.:.||
Zfish   199 LAIGVSMALNCGYPINPARDLGPRLFTAIAGWGLTVFSAGNGWW---WVPVVGPMVGGVVGAAIY 260

  Fly   262  261
            Zfish   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 72/258 (28%)
aqp9bNP_001171215.1 MIP 22..228 CDD:238204 61/220 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573502
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.