DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and aqp8a.2

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001073651.1 Gene:aqp8a.2 / 563130 ZFINID:ZDB-GENE-070112-1802 Length:257 Species:Danio rerio


Alignment Length:214 Identity:61/214 - (28%)
Similarity:105/214 - (49%) Gaps:7/214 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LAEMIATAMLMFLGCMGSVENSVFTNSDFQSALNFGFVVLICIQCFGCVCGAHLNPAVTLATYVY 114
            :||::.|...:|:||:..:|| |......|.||..|..|.:.:.|...:.|:|.||..|:|.::.
Zfish    37 IAELVGTTFFVFIGCVSVIEN-VEAAGRLQPALVHGLAVAVLVACMAEISGSHFNPPFTIAIWLC 100

  Fly   115 NMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNSTLTPWQGLAVEFLI 179
            ..:.|.|.:.|.::|::|..:|..:.| |:.....|:  |..|.....|.|.....:.:..|..:
Zfish   101 GGMQLTMVVPYLISQLIGGVLGAAMSK-VMTSDENYA--NATGAAFAVLKSDEQLGKVVFAEMAM 162

  Fly   180 TC-VLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPAIWNGFWDDH 243
            || |.:.|..|..:.:  :|...:|...|..:....|..|.::|..:||.|:|.||:....|..|
Zfish   163 TCLVTLVVLMGAVNGK--SKSPMVPFMVGCTVIVNILAGGDVSGTCLNPARAFGPALVANHWTYH 225

  Fly   244 WIYWVGPMAAALITSVIYK 262
            |:|||||:...|:.:.:.:
Zfish   226 WVYWVGPLGGGLVAAALMR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 61/211 (29%)
aqp8a.2NP_001073651.1 MIP 36..246 CDD:294134 61/214 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573478
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.