DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and aqp1a.2

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001129154.1 Gene:aqp1a.2 / 559284 ZFINID:ZDB-GENE-100409-1 Length:269 Species:Danio rerio


Alignment Length:265 Identity:78/265 - (29%)
Similarity:122/265 - (46%) Gaps:23/265 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RQLDSIT---TVLAEMIATAMLMFLGCMGSVEN--SVFTNSDFQSALNFGFVVLICIQCFGCVCG 100
            |:|.|.:   .||||.:...:.:|:|...::.|  :.:.:.:.:.||.||..:....|..|.:.|
Zfish     3 RELKSWSFWRAVLAEFVGMTIFVFIGIASAIGNKHNRYPDQEVKVALAFGLAIATLAQSLGHISG 67

  Fly   101 AHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVC-LTSLN 164
            ||||||:||...|...||...|..|.:|||:||.:..|::..|.|:        |:... |..|.
Zfish    68 AHLNPAITLGLLVSCQISFFRAFMYIIAQMLGAVLASGIMFKVSPD--------PDTTLGLNMLG 124

  Fly   165 STLTPWQGLAVEFLITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVR 229
            :.:...||.|:|...|..|:.......|........|.|:..||::....|.|...||..:||.|
Zfish   125 NGVKVGQGFAIELFTTFQLVLCALATTDKNRTDVSGSAPLAIGLSVGLGHLVAISYTGCGINPAR 189

  Fly   230 SFAPAIWNGFWDDHWIYWVGPMAAALITSVIY-------KHAFRRELE--ESEVDETTMSTKRTS 285
            ||.||:....:.:|||||:.||...:..::||       :.|.|:.:.  :...|....:|:...
Zfish   190 SFGPAVVLESFKNHWIYWIAPMCGGVAAALIYDFLLFPKREALRKRMNVLKGTADPDPSATEALI 254

  Fly   286 EAELA 290
            |...|
Zfish   255 EPRSA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 70/225 (31%)
aqp1a.2NP_001129154.1 MIP 4..221 CDD:278651 69/224 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573518
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.