DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and aqp2

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001015749.1 Gene:aqp2 / 548466 XenbaseID:XB-GENE-481401 Length:273 Species:Xenopus tropicalis


Alignment Length:223 Identity:76/223 - (34%)
Similarity:112/223 - (50%) Gaps:13/223 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ITTVLAEMIATAMLMFLGCMGSVENSVFTNSDFQSALNFGFVVLICIQCFGCVCGAHLNPAVTLA 110
            :..|.||.:||.:.:|||...::.......:..|.:|.||..:...:|.||.:.|||:|||||:|
 Frog    11 VRAVFAEFLATMIFVFLGMGSALSWKPSLPNVLQISLAFGLAISTLVQAFGHISGAHINPAVTIA 75

  Fly   111 TYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESA---IYSAENPNGVCLTSLNSTLTPWQG 172
            ..:...||...||.|.:||:|||..|..::.|:.|..|   :...|..||          :|.|.
 Frog    76 FLIGCHISFLRALFYIIAQLVGAIAGAAIVSAIAPLDARGNLAINEVTNG----------SPGQA 130

  Fly   173 LAVEFLITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRSFAPAIWN 237
            .|||..:|..|:.......|.|.:....|..:..||::....|....|||.||||.|||.||...
 Frog   131 CAVELFLTFQLVLCVFASTDSRRSDNVGSPAISIGLSVTVGHLLGIYLTGCSMNPARSFGPAAIT 195

  Fly   238 GFWDDHWIYWVGPMAAALITSVIYKHAF 265
            |.:.|||::|:||:...::.|:.|.:.|
 Frog   196 GIFTDHWVFWIGPLVGGILASLFYNYIF 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 74/217 (34%)
aqp2NP_001015749.1 MIP 4..219 CDD:333943 74/217 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.