DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp2 and aqp7

DIOPT Version :9

Sequence 1:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001015726.1 Gene:aqp7 / 548443 XenbaseID:XB-GENE-484060 Length:299 Species:Xenopus tropicalis


Alignment Length:261 Identity:66/261 - (25%)
Similarity:114/261 - (43%) Gaps:36/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LAEMIATAMLMFLGCMGSVENSVFTNSDF----QSALNFGFVVLICIQCFGCVCGAHLNPAVTLA 110
            |||:::|.::|..| :||....|....:|    ...|:|||.|.:.|...|.|.|||:|.||:|.
 Frog    26 LAELLSTFIMMLFG-LGSCAQVVLGKHEFGQYLSINLSFGFGVTMGIHVAGGVSGAHMNSAVSLT 89

  Fly   111 TYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPES------AIYSAENPN---GVCLTSLNST 166
            ..|...:.......|.:|||:|:|:...::..:..|:      .|::...||   .:..|.....
 Frog    90 NCVLGNLPWRKLPVYVLAQMLGSFLAAVVVYCLYSEALYNYCGGIFTVTGPNETASIFATYPQPY 154

  Fly   167 LTPWQGLAVEFLITCVLISVCCGVWDPRNA-TKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRS 230
            |:...|...:.:.|..|:.....:.|.:|: ..:.:..|..||.:..:.::.|..:|.::||.|.
 Frog   155 LSIGGGFLDQVIGTGALLLCLLAIGDRKNSPALKGTEAVIVGLLVTVIGMSMGMNSGYAINPARD 219

  Fly   231 FAPAIWNG-------------FWDDHWIYWVGPMAAALITSVIYK-----HAFRRELEESEVDET 277
            ..|.|:..             :|.  |:..|.|....|..:.:||     | .:.|.||::.:|.
 Frog   220 LGPRIFTAIAGWGIEVFRAGHYWS--WVPIVAPCVGGLTGAFLYKLLVGLH-HQPEEEETKEEEV 281

  Fly   278 T 278
            |
 Frog   282 T 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp2NP_788433.2 MIP 41..261 CDD:294134 58/237 (24%)
aqp7NP_001015726.1 MIP 21..266 CDD:350945 60/242 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.